![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein GTPase Era, N-terminal domain [52637] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52638] (2 PDB entries) |
![]() | Domain d1x1lx1: 1x1l X:4-182 [121590] Other proteins in same PDB: d1x1lx2 automatically matched to d1egaa1 protein/RNA complex |
PDB Entry: 1x1l (more details)
SCOPe Domain Sequences for d1x1lx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1lx1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe
Timeline for d1x1lx1: