Lineage for d1x1ja3 (1x1j A:387-659)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664644Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 664687Protein Xanthan lyase [89282] (1 species)
  7. 664688Species Bacillus sp. gl1 [TaxId:84635] [89283] (7 PDB entries)
  8. 664690Domain d1x1ja3: 1x1j A:387-659 [121589]
    Other proteins in same PDB: d1x1ja1, d1x1ja2
    automatically matched to d1j0ma3
    complexed with 46d, ca; mutant

Details for d1x1ja3

PDB Entry: 1x1j (more details), 2.1 Å

PDB Description: crystal structure of xanthan lyase (n194a) with a substrate.
PDB Compounds: (A:) xanthan lyase

SCOP Domain Sequences for d1x1ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ja3 b.30.5.2 (A:387-659) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

SCOP Domain Coordinates for d1x1ja3:

Click to download the PDB-style file with coordinates for d1x1ja3.
(The format of our PDB-style files is described here.)

Timeline for d1x1ja3: