![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Bacillus sp. [TaxId:84635] [254959] (5 PDB entries) |
![]() | Domain d1x1ja3: 1x1j A:387-659 [121589] Other proteins in same PDB: d1x1ja1, d1x1ja2 automated match to d1x1ia3 complexed with 46d, ca |
PDB Entry: 1x1j (more details), 2.1 Å
SCOPe Domain Sequences for d1x1ja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ja3 b.30.5.0 (A:387-659) automated matches {Bacillus sp. [TaxId: 84635]} pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet mwidhgtnpsgasygyvllpnktsaqvgayaad
Timeline for d1x1ja3: