Lineage for d1x1ia3 (1x1i A:387-659)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782802Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 1782803Protein automated matches [226849] (5 species)
    not a true protein
  7. 1782804Species Bacillus sp. [TaxId:84635] [254959] (5 PDB entries)
  8. 1782805Domain d1x1ia3: 1x1i A:387-659 [121586]
    Other proteins in same PDB: d1x1ia1, d1x1ia2
    automated match to d1x1ia3
    complexed with 46m

Details for d1x1ia3

PDB Entry: 1x1i (more details), 1.8 Å

PDB Description: crystal structure of xanthan lyase (n194a) complexed with a product
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1x1ia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ia3 b.30.5.0 (A:387-659) automated matches {Bacillus sp. [TaxId: 84635]}
pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla
qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls
arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt
ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnyet
mwidhgtnpsgasygyvllpnktsaqvgayaad

SCOPe Domain Coordinates for d1x1ia3:

Click to download the PDB-style file with coordinates for d1x1ia3.
(The format of our PDB-style files is described here.)

Timeline for d1x1ia3: