Class b: All beta proteins [48724] (178 folds) |
Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) |
Family b.24.1.0: automated matches [254204] (1 protein) not a true family |
Protein automated matches [254449] (1 species) not a true protein |
Species Bacillus sp. [TaxId:84635] [254960] (5 PDB entries) |
Domain d1x1ha2: 1x1h A:660-777 [121582] Other proteins in same PDB: d1x1ha1, d1x1ha3 automated match to d1x1ia2 |
PDB Entry: 1x1h (more details), 2.3 Å
SCOPe Domain Sequences for d1x1ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ha2 b.24.1.0 (A:660-777) automated matches {Bacillus sp. [TaxId: 84635]} paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg
Timeline for d1x1ha2: