Lineage for d1x1ha1 (1x1h A:26-386)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335526Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2335544Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2335591Protein automated matches [254448] (1 species)
    not a true protein
  7. 2335592Species Bacillus sp. [TaxId:84635] [254958] (5 PDB entries)
  8. 2335597Domain d1x1ha1: 1x1h A:26-386 [121581]
    Other proteins in same PDB: d1x1ha2, d1x1ha3
    automated match to d1j0ma1

Details for d1x1ha1

PDB Entry: 1x1h (more details), 2.3 Å

PDB Description: crystal structure of xanthan lyase (n194a)
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1x1ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ha1 a.102.3.2 (A:26-386) automated matches {Bacillus sp. [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltgaarawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOPe Domain Coordinates for d1x1ha1:

Click to download the PDB-style file with coordinates for d1x1ha1.
(The format of our PDB-style files is described here.)

Timeline for d1x1ha1: