Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) incomplete toroid |
Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins) |
Protein automated matches [254448] (1 species) not a true protein |
Species Bacillus sp. [TaxId:84635] [254958] (5 PDB entries) |
Domain d1x1ha1: 1x1h A:26-386 [121581] Other proteins in same PDB: d1x1ha2, d1x1ha3 automated match to d1j0ma1 |
PDB Entry: 1x1h (more details), 2.3 Å
SCOPe Domain Sequences for d1x1ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ha1 a.102.3.2 (A:26-386) automated matches {Bacillus sp. [TaxId: 84635]} sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltgaarawqaivvgvr avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa a
Timeline for d1x1ha1: