SCOPe 2.03: Domain d1x1ha1: 1x1h A:26-386

Lineage for d1x1ha1 (1x1h A:26-386)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families)
   incomplete toroid

5. Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)

6. Protein Xanthan lyase [89111] (1 species)

7. Species Bacillus sp. GL1 [TaxId:84635] [89112] (7 PDB entries)

8. Domain d1x1ha1: 1x1h A:26-386 [121581]
   Other proteins in same PDB: d1x1ha2, d1x1ha3
   automatically matched to d1j0ma1

Details for d1x1ha1

PDB Entry: 1x1h, 2.3 Å

PDB Description: crystal structure of xanthan lyase (n194a)

PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1x1ha1:

Sequence; same for both SEQRES and ATOM records:

>d1x1ha1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltgaarawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

Timeline for d1x1ha1:

• d1x1ha1 first appeared in SCOP 1.73
  
• d1x1ha1 appears in SCOPe 2.02
  
• d1x1ha1 appears in SCOPe 2.04
  
• d1x1ha1 appears in the current release, SCOPe 2.08