Lineage for d1x1ga1 (1x1g A:8-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673130Protein Pleckstrin-2 [141409] (1 species)
  7. 673131Species Human (Homo sapiens) [TaxId:9606] [141410] (1 PDB entry)
  8. 673132Domain d1x1ga1: 1x1g A:8-123 [121580]
    2nd PH domain

Details for d1x1ga1

PDB Entry: 1x1g (more details)

PDB Description: Solution structure of the C-terminal PH domain of human pleckstrin 2
PDB Compounds: (A:) Pleckstrin 2

SCOP Domain Sequences for d1x1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}
slstvelsgtvvkqgylakqghkrknwkvrrfvlrkdpaflhyydpskeenrpvggfslr
gslvsaledngvptgvkgnvqgnlfkvitkddthyyiqasskaeraewieaikklt

SCOP Domain Coordinates for d1x1ga1:

Click to download the PDB-style file with coordinates for d1x1ga1.
(The format of our PDB-style files is described here.)

Timeline for d1x1ga1: