Lineage for d1x1ga1 (1x1g A:8-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803232Protein Pleckstrin-2 [141409] (1 species)
  7. 2803233Species Human (Homo sapiens) [TaxId:9606] [141410] (1 PDB entry)
    Uniprot Q9NYT0 238-353
  8. 2803234Domain d1x1ga1: 1x1g A:8-123 [121580]
    Other proteins in same PDB: d1x1ga2, d1x1ga3
    2nd PH domain

Details for d1x1ga1

PDB Entry: 1x1g (more details)

PDB Description: solution structure of the c-terminal ph domain of human pleckstrin 2
PDB Compounds: (A:) Pleckstrin 2

SCOPe Domain Sequences for d1x1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}
slstvelsgtvvkqgylakqghkrknwkvrrfvlrkdpaflhyydpskeenrpvggfslr
gslvsaledngvptgvkgnvqgnlfkvitkddthyyiqasskaeraewieaikklt

SCOPe Domain Coordinates for d1x1ga1:

Click to download the PDB-style file with coordinates for d1x1ga1.
(The format of our PDB-style files is described here.)

Timeline for d1x1ga1: