Lineage for d1x1fa1 (1x1f A:8-143)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412807Protein Signal-transducing adaptor protein 1, STAP-1 [141405] (1 species)
  7. 2412808Species Human (Homo sapiens) [TaxId:9606] [141406] (1 PDB entry)
    Uniprot Q9ULZ2 16-151
  8. 2412809Domain d1x1fa1: 1x1f A:8-143 [121579]
    Other proteins in same PDB: d1x1fa2, d1x1fa3

Details for d1x1fa1

PDB Entry: 1x1f (more details)

PDB Description: solution structure of the ph domain of human docking protein brdg1
PDB Compounds: (A:) Signal-transducing adaptor protein 1

SCOPe Domain Sequences for d1x1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]}
qerlkitalplyfegfllikrsgyreyehywtelrgttlffytdkksiiyvdkldivdlt
clteqnstekncakftlvlpkeevqlktentesgeewrgfiltvtelsvpqnvsllpgqv
iklhevlerekkrrie

SCOPe Domain Coordinates for d1x1fa1:

Click to download the PDB-style file with coordinates for d1x1fa1.
(The format of our PDB-style files is described here.)

Timeline for d1x1fa1: