Lineage for d1x18x2 (1x18 X:183-295)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025652Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1025679Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1025680Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1025681Protein GTPase Era C-terminal domain [54818] (2 species)
  7. 1025682Species Escherichia coli [TaxId:562] [54819] (3 PDB entries)
  8. 1025685Domain d1x18x2: 1x18 X:183-295 [121578]
    Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18h1, d1x18x1
    automatically matched to d1egab2
    protein/RNA complex

Details for d1x18x2

PDB Entry: 1x18 (more details), 13.5 Å

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit
PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x18x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x18x2 d.52.3.1 (X:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl

SCOPe Domain Coordinates for d1x18x2:

Click to download the PDB-style file with coordinates for d1x18x2.
(The format of our PDB-style files is described here.)

Timeline for d1x18x2: