![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries) |
![]() | Domain d1x18h1: 1x18 H:16-88 [121576] Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18x1, d1x18x2 automatically matched to d1i94r_ complexed with du |
PDB Entry: 1x18 (more details)
SCOP Domain Sequences for d1x18h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x18h1 a.4.8.1 (H:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1x18h1: