![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47977] (38 PDB entries) |
![]() | Domain d1x18f1: 1x18 F:2-156 [121574] Other proteins in same PDB: d1x18e1, d1x18g1, d1x18h1, d1x18x1, d1x18x2 automatically matched to d1fjgg_ complexed with du |
PDB Entry: 1x18 (more details)
SCOP Domain Sequences for d1x18f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x18f1 a.75.1.1 (F:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsrrqqslalrwlvqaanqrperraavriah elmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1x18f1: