SCOPe 2.08: Domain d1x0sa_: 1x0s A:

Lineage for d1x0sa_ (1x0s A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein automated matches [190122] (8 species)
   not a true protein

7. Species Halobacterium salinarum [TaxId:2242] [186845] (18 PDB entries)

8. Domain d1x0sa_: 1x0s A: [121572]
   automated match to d1cwqa_
   complexed with l2p, l3p, ret, so4

Details for d1x0sa_

PDB Entry: 1x0s, 2.5 Å

PDB Description: crystal structure of the 13-cis isomer of bacteriorhodopsin

PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d1x0sa_:

Sequence; same for both SEQRES and ATOM records:

>d1x0sa_ f.13.1.1 (A:) automated matches {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d1x0sa_:

• d1x0sa_ first appeared in SCOP 1.73, called d1x0sa1
  
• d1x0sa_ appears in SCOPe 2.07