![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Peroxiredoxin [117601] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [117602] (2 PDB entries) Uniprot Q9Y9L0 # APE2278 |
![]() | Domain d1x0rh_: 1x0r H: [121569] automated match to d1vgsd_ complexed with edo |
PDB Entry: 1x0r (more details), 2 Å
SCOPe Domain Sequences for d1x0rh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0rh_ c.47.1.10 (H:) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii geglivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakll yeea
Timeline for d1x0rh_: