Lineage for d1x0rg_ (1x0r G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877632Protein Peroxiredoxin [117601] (1 species)
  7. 2877633Species Aeropyrum pernix [TaxId:56636] [117602] (2 PDB entries)
    Uniprot Q9Y9L0 # APE2278
  8. 2877640Domain d1x0rg_: 1x0r G: [121568]
    automated match to d1vgsd_
    complexed with edo

Details for d1x0rg_

PDB Entry: 1x0r (more details), 2 Å

PDB Description: thioredoxin peroxidase from aeropyrum pernix k1
PDB Compounds: (G:) Probable peroxiredoxin

SCOPe Domain Sequences for d1x0rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0rg_ c.47.1.10 (G:) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakll
yeea

SCOPe Domain Coordinates for d1x0rg_:

Click to download the PDB-style file with coordinates for d1x0rg_.
(The format of our PDB-style files is described here.)

Timeline for d1x0rg_: