Lineage for d1x0pj_ (1x0p J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909557Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1909595Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 1909600Protein Hypothetical protein Tll0078 [143369] (1 species)
  7. 1909601Species Thermosynechococcus elongatus [TaxId:146786] [143370] (1 PDB entry)
    Uniprot Q8DMN3 2-143
  8. 1909611Domain d1x0pj_: 1x0p J: [121561]
    automated match to d1x0pa1
    complexed with fad

Details for d1x0pj_

PDB Entry: 1x0p (more details), 2 Å

PDB Description: structure of a cyanobacterial bluf protein, tll0078
PDB Compounds: (J:) hypothetical protein Tll0078

SCOPe Domain Sequences for d1x0pj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0pj_ d.58.10.2 (J:) Hypothetical protein Tll0078 {Thermosynechococcus elongatus [TaxId: 146786]}
glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
rsmtaeqcfrflkelydms

SCOPe Domain Coordinates for d1x0pj_:

Click to download the PDB-style file with coordinates for d1x0pj_.
(The format of our PDB-style files is described here.)

Timeline for d1x0pj_: