Lineage for d1x0pb1 (1x0p B:1002-1140)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862748Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families) (S)
  5. 862769Family d.58.10.2: BLUF domain [143364] (3 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 862774Protein Hypothetical protein Tll0078 [143369] (1 species)
  7. 862775Species Thermosynechococcus elongatus [TaxId:146786] [143370] (1 PDB entry)
    Uniprot Q8DMN3 2-143
  8. 862777Domain d1x0pb1: 1x0p B:1002-1140 [121553]
    automatically matched to 1X0P A:102-243
    complexed with fad

Details for d1x0pb1

PDB Entry: 1x0p (more details), 2 Å

PDB Description: structure of a cyanobacterial bluf protein, tll0078
PDB Compounds: (B:) hypothetical protein Tll0078

SCOP Domain Sequences for d1x0pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0pb1 d.58.10.2 (B:1002-1140) Hypothetical protein Tll0078 {Thermosynechococcus elongatus [TaxId: 146786]}
glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
rsmtaeqcfrflkelydms

SCOP Domain Coordinates for d1x0pb1:

Click to download the PDB-style file with coordinates for d1x0pb1.
(The format of our PDB-style files is described here.)

Timeline for d1x0pb1: