SCOPe 2.07: Domain d1x0k1_: 1x0k 1:

Lineage for d1x0k1_ (1x0k 1:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein automated matches [190122] (8 species)
   not a true protein

7. Species Halobacterium salinarum [TaxId:2242] [186845] (18 PDB entries)

8. Domain d1x0k1_: 1x0k 1: [121549]
   automated match to d1cwqa_
   complexed with l2p, l3p, ret

Details for d1x0k1_

PDB Entry: 1x0k, 2.6 Å

PDB Description: crystal structure of bacteriorhodopsin at ph 10

PDB Compounds: (1:) bacteriorhodopsin

SCOPe Domain Sequences for d1x0k1_:

Sequence; same for both SEQRES and ATOM records:

>d1x0k1_ f.13.1.1 (1:) automated matches {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d1x0k1_:

• d1x0k1_ first appeared in SCOP 1.73, called d1x0k11
  
• d1x0k1_ appears in SCOPe 2.06
  
• d1x0k1_ appears in the current release, SCOPe 2.08