Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein automated matches [190122] (8 species) not a true protein |
Species Halobacterium salinarum [TaxId:2242] [186845] (18 PDB entries) |
Domain d1x0k1_: 1x0k 1: [121549] automated match to d1cwqa_ complexed with l2p, l3p, ret |
PDB Entry: 1x0k (more details), 2.6 Å
SCOPe Domain Sequences for d1x0k1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0k1_ f.13.1.1 (1:) automated matches {Halobacterium salinarum [TaxId: 2242]} tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg
Timeline for d1x0k1_: