![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.332: RGC domain-like [143884] (1 superfamily) consists of two beta-sheets and four helices eclosing a cental cavity |
![]() | Superfamily d.332.1: RGC domain-like [143885] (1 family) ![]() |
![]() | Family d.332.1.1: RGC domain [143886] (2 proteins) Pfam PF03836; RasGAP C-terminus |
![]() | Protein Ras GTPase-activating-like protein IQGAP1 [143887] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143888] (1 PDB entry) Uniprot P46940 1559-1657 |
![]() | Domain d1x0ha1: 1x0h A:8-106 [121547] Other proteins in same PDB: d1x0ha2, d1x0ha3 |
PDB Entry: 1x0h (more details)
SCOPe Domain Sequences for d1x0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0ha1 d.332.1.1 (A:8-106) Ras GTPase-activating-like protein IQGAP1 {Human (Homo sapiens) [TaxId: 9606]} islkytaarlhekgvlleiedlqvnqfknvifeispteevgdfevkakfmgvqmetfmlh yqdllqlqyegvavmklfdrakvnvnllifllnkkfygk
Timeline for d1x0ha1: