Lineage for d1x0ha1 (1x0h A:8-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011152Fold d.332: RGC domain-like [143884] (1 superfamily)
    consists of two beta-sheets and four helices eclosing a cental cavity
  4. 3011153Superfamily d.332.1: RGC domain-like [143885] (1 family) (S)
  5. 3011154Family d.332.1.1: RGC domain [143886] (2 proteins)
    Pfam PF03836; RasGAP C-terminus
  6. 3011155Protein Ras GTPase-activating-like protein IQGAP1 [143887] (1 species)
  7. 3011156Species Human (Homo sapiens) [TaxId:9606] [143888] (1 PDB entry)
    Uniprot P46940 1559-1657
  8. 3011157Domain d1x0ha1: 1x0h A:8-106 [121547]
    Other proteins in same PDB: d1x0ha2, d1x0ha3

Details for d1x0ha1

PDB Entry: 1x0h (more details)

PDB Description: solution structure of the carboxyl-terminal rgc domain in human iqgap1
PDB Compounds: (A:) Ras GTPase-activating-like protein IQGAP1

SCOPe Domain Sequences for d1x0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0ha1 d.332.1.1 (A:8-106) Ras GTPase-activating-like protein IQGAP1 {Human (Homo sapiens) [TaxId: 9606]}
islkytaarlhekgvlleiedlqvnqfknvifeispteevgdfevkakfmgvqmetfmlh
yqdllqlqyegvavmklfdrakvnvnllifllnkkfygk

SCOPe Domain Coordinates for d1x0ha1:

Click to download the PDB-style file with coordinates for d1x0ha1.
(The format of our PDB-style files is described here.)

Timeline for d1x0ha1: