Lineage for d1x0fa_ (1x0f A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908947Domain d1x0fa_: 1x0f A: [121546]
    automated match to d1x0fa1
    protein/DNA complex; protein/RNA complex

Details for d1x0fa_

PDB Entry: 1x0f (more details)

PDB Description: complex structure of the c-terminal rna-binding domain of hnrnp d(auf1) with telomeric dna
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d1x0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0fa_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkkifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkim
ekkyhnvglskceikvams

SCOPe Domain Coordinates for d1x0fa_:

Click to download the PDB-style file with coordinates for d1x0fa_.
(The format of our PDB-style files is described here.)

Timeline for d1x0fa_: