![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
![]() | Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75440] (3 PDB entries) |
![]() | Domain d1x0fa1: 1x0f A:183-257 [121546] automatically matched to d1iqta_ |
PDB Entry: 1x0f (more details)
SCOP Domain Sequences for d1x0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek kyhnvglskceikva
Timeline for d1x0fa1: