Lineage for d1x04a1 (1x04 A:26-225)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350990Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2350991Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2350992Family a.238.1.1: BAR domain [103658] (4 proteins)
    sensor of membrane curvature
  6. 2350999Protein Endophilin-1 [140699] (3 species)
    SH3-containing GRB2-like protein 2
  7. 2351000Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries)
    Uniprot Q99962 11-247! Uniprot Q99962 26-247
  8. 2351003Domain d1x04a1: 1x04 A:26-225 [121542]
    mutant

Details for d1x04a1

PDB Entry: 1x04 (more details), 2.9 Å

PDB Description: crystal structure of endophilin bar domain (mutant)
PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d1x04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x04a1 a.238.1.1 (A:26-225) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
gtkldddfkemerkvdvtsravmeimtktieylahlssllqaeallaeamlkfgrelgdd
cnfgpalgevgeamrelsevkdsldievkqnfidplqnlhdkdlreiqhhlkklegrrld
fdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk
qavqilqqvtvrleerirqa

SCOPe Domain Coordinates for d1x04a1:

Click to download the PDB-style file with coordinates for d1x04a1.
(The format of our PDB-style files is described here.)

Timeline for d1x04a1: