SCOP 1.73: Domain d1x04a1: 1x04 A:26-225

Lineage for d1x04a1 (1x04 A:26-225)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (3 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (2 proteins)
   sensor of membrane curvature

6. Protein Endophilin-1 [140699] (3 species)
   SH3-containing GRB2-like protein 2

7. Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries)

8. Domain d1x04a1: 1x04 A:26-225 [121542]
   mutant

Details for d1x04a1

PDB Entry: 1x04, 2.9 Å

PDB Description: crystal structure of endophilin bar domain (mutant)

PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOP Domain Sequences for d1x04a1:

Sequence; same for both SEQRES and ATOM records:

>d1x04a1 a.238.1.1 (A:26-225) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
gtkldddfkemerkvdvtsravmeimtktieylahlssllqaeallaeamlkfgrelgdd
cnfgpalgevgeamrelsevkdsldievkqnfidplqnlhdkdlreiqhhlkklegrrld
fdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk
qavqilqqvtvrleerirqa

Timeline for d1x04a1:

• d1x04a1 is new in SCOP 1.73
  
• d1x04a1 appears in SCOP 1.75
  
• d1x04a1 appears in the current release, SCOPe 2.08