![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
![]() | Protein Endophilin-1 [140699] (3 species) SH3-containing GRB2-like protein 2 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries) Uniprot Q99962 11-247! Uniprot Q99962 26-247 |
![]() | Domain d1x03a1: 1x03 A:26-247 [121541] |
PDB Entry: 1x03 (more details), 3.1 Å
SCOPe Domain Sequences for d1x03a1:
Sequence, based on SEQRES records: (download)
>d1x03a1 a.238.1.1 (A:26-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} gtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmintmskirgqekgpg ypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqn lhdkdlreiqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessmfnll emdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa
>d1x03a1 a.238.1.1 (A:26-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} gtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmipgypqaeallaeam lkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnlhdkdlreiqhh lkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsa lvqaqleyhkqavqilqqvtvrleerirqa
Timeline for d1x03a1: