SCOPe 2.01: Domain d1x01b2: 1x01 B:1-188

Lineage for d1x01b2 (1x01 B:1-188)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries)
   Uniprot O57883 1-188

8. Domain d1x01b2: 1x01 B:1-188 [121540]
   Other proteins in same PDB: d1x01a1, d1x01b1
   automatically matched to 1WNL A:1-188
   complexed with acy, atp, po4

Details for d1x01b2

PDB Entry: 1x01, 2 Å

PDB Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 in complex with ATP

PDB Compounds: (B:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d1x01b2:

Sequence; same for both SEQRES and ATOM records:

>d1x01b2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d1x01b2:

• d1x01b2 first appeared in SCOP 1.73
  
• d1x01b2 appears in SCOP 1.75
  
• d1x01b2 appears in SCOPe 2.02
  
• d1x01b2 appears in the current release, SCOPe 2.08