Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins) |
Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries) Uniprot O57883 1-188 |
Domain d1x01b2: 1x01 B:1-188 [121540] Other proteins in same PDB: d1x01a1, d1x01b1 automatically matched to 1WNL A:1-188 complexed with acy, atp, po4 |
PDB Entry: 1x01 (more details), 2 Å
SCOP Domain Sequences for d1x01b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x01b2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d1x01b2: