Lineage for d1x01a2 (1x01 A:1-188)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574513Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 2574522Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 2574523Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
    Uniprot O57883 1-188
  8. 2574568Domain d1x01a2: 1x01 A:1-188 [121538]
    Other proteins in same PDB: d1x01a1, d1x01b1
    automated match to d1wnla2
    complexed with acy, atp, po4

Details for d1x01a2

PDB Entry: 1x01 (more details), 2 Å

PDB Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 in complex with ATP
PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d1x01a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x01a2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d1x01a2:

Click to download the PDB-style file with coordinates for d1x01a2.
(The format of our PDB-style files is described here.)

Timeline for d1x01a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x01a1