Lineage for d1wzza1 (1wzz A:23-341)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004135Protein Probable endoglucanase CmcAX [140786] (1 species)
  7. 2004136Species Acetobacter xylinus [TaxId:28448] [140787] (1 PDB entry)
    Uniprot P37696 23-341
  8. 2004137Domain d1wzza1: 1wzz A:23-341 [121536]
    complexed with so4

Details for d1wzza1

PDB Entry: 1wzz (more details), 1.65 Å

PDB Description: Structure of endo-beta-1,4-glucanase CMCax from Acetobacter xylinum
PDB Compounds: (A:) Probable endoglucanase

SCOPe Domain Sequences for d1wzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzza1 a.102.1.2 (A:23-341) Probable endoglucanase CmcAX {Acetobacter xylinus [TaxId: 28448]}
apdavaqqwaifrakylrpsgrvvdtgnggeshsegqgygmlfaasagdlasfqsmwmwa
rtnlqhtndklfswrflkghqppvpdknnatdgdllialalgragkrfqrpdyiqdamai
ygdvlnlmtmkagpyvvlmpgavgftkkdsvilnlsyyvmpsllqafdltadprwrqvme
dgirlvsagrfgqwrlppdwlavnratgalsiasgwpprfsydairvplyfywahmlapn
vladftrfwnnfganalpgwvdlttgarspynappgylavaectgldsagelptldhapd
yysaaltllvyiaraeeti

SCOPe Domain Coordinates for d1wzza1:

Click to download the PDB-style file with coordinates for d1wzza1.
(The format of our PDB-style files is described here.)

Timeline for d1wzza1: