Lineage for d1wzxb1 (1wzx B:8-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774862Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (2 proteins)
  6. 2774863Protein Endoglucanase CelJ [110126] (1 species)
  7. 2774864Species Clostridium thermocellum [TaxId:1515] [110127] (2 PDB entries)
    Uniprot P71140 34-228 # chain B coverage
  8. 2774868Domain d1wzxb1: 1wzx B:8-180 [121533]
    automatically matched to d1wmxa_

Details for d1wzxb1

PDB Entry: 1wzx (more details), 3.52 Å

PDB Description: Crystal Structure of Family 30 Carbohydrate Binding Module.
PDB Compounds: (B:) COG3291: FOG: PKD repeat

SCOPe Domain Sequences for d1wzxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzxb1 b.18.1.24 (B:8-180) Endoglucanase CelJ {Clostridium thermocellum [TaxId: 1515]}
lldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwisl
ltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyv
tvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse

SCOPe Domain Coordinates for d1wzxb1:

Click to download the PDB-style file with coordinates for d1wzxb1.
(The format of our PDB-style files is described here.)

Timeline for d1wzxb1: