Lineage for d1wzwa1 (1wzw A:2-151)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (4 families) 
Family d.20.1.1: UBC-related [54496] (6 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species) 
Species Human (Homo sapiens), E2 L6 [TaxId:9606] [143052] (2 PDB entries)
Uniprot O14933 2-151
Domain d1wzwa1: 1wzw A:2-151 [121531]
automatically matched to 1WZV A:2-151
Details for d1wzwa1
PDB Entry: 1wzw (more details), 2.4 Å
PDB Description: Crystal Structure of UbcH8
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 L6SCOP Domain Sequences for d1wzwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzwa1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]}
asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp
fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr
mdladlltqnpelfrknaeeftlrfgvdrp
SCOP Domain Coordinates for d1wzwa1:
Click to download the PDB-style file with coordinates for d1wzwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wzwa1:
- d1wzwa1 first appeared in SCOP 1.73
- d1wzwa1 is called d1wzwa_ in SCOPe 2.01
- d1wzwa1 appears in the current release, SCOPe 2.08, called d1wzwa2
View in 3D