Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) |
Species Human (Homo sapiens), E2 L6 [TaxId:9606] [143052] (2 PDB entries) |
Domain d1wzvb1: 1wzv B:2-151 [121530] automatically matched to 1WZV A:2-151 |
PDB Entry: 1wzv (more details), 2.1 Å
SCOP Domain Sequences for d1wzvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzvb1 d.20.1.1 (B:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr mdladlltqnpelfrknaeeftlrfgvdrp
Timeline for d1wzvb1: