Lineage for d1wzva1 (1wzv A:2-151)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642862Species Human (Homo sapiens), E2 L6 [TaxId:9606] [143052] (1 PDB entry)
    Uniprot O14933 2-151
  8. 1642863Domain d1wzva1: 1wzv A:2-151 [121529]
    Other proteins in same PDB: d1wzvb_

Details for d1wzva1

PDB Entry: 1wzv (more details), 2.1 Å

PDB Description: Crystal Structure of UbcH8
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 L6

SCOPe Domain Sequences for d1wzva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]}
asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp
fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr
mdladlltqnpelfrknaeeftlrfgvdrp

SCOPe Domain Coordinates for d1wzva1:

Click to download the PDB-style file with coordinates for d1wzva1.
(The format of our PDB-style files is described here.)

Timeline for d1wzva1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wzvb_