Lineage for d1wzva1 (1wzv A:2-151)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (4 families) 
Family d.20.1.1: UBC-related [54496] (6 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) 
Species Human (Homo sapiens), E2 L6 [TaxId:9606] [143052] (2 PDB entries) 
Domain d1wzva1: 1wzv A:2-151 [121529]
Details for d1wzva1
PDB Entry: 1wzv (more details), 2.1 Å
PDB Description: Crystal Structure of UbcH8
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 L6SCOP Domain Sequences for d1wzva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]}
asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp
fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr
mdladlltqnpelfrknaeeftlrfgvdrp
SCOP Domain Coordinates for d1wzva1:
Click to download the PDB-style file with coordinates for d1wzva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wzva1:
- d1wzva1 is new in SCOP 1.73
- d1wzva1 appears in SCOP 1.75
- d1wzva1 appears in the current release, SCOPe 2.08
View in 3D
