Lineage for d1wzua1 (1wzu A:1-298)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152064Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2152065Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2152066Family c.145.1.1: NadA-like [142755] (1 protein)
    Pfam PF02445
  6. 2152067Protein Quinolinate synthetase A, NadA [142756] (2 species)
  7. 2152068Species Pyrococcus horikoshii [TaxId:53953] [142757] (1 PDB entry)
    Uniprot O57767 1-298
  8. 2152069Domain d1wzua1: 1wzu A:1-298 [121528]
    complexed with mlt

Details for d1wzua1

PDB Entry: 1wzu (more details), 2 Å

PDB Description: Crystal structure of quinolinate synthase (nadA)
PDB Compounds: (A:) Quinolinate synthetase A

SCOPe Domain Sequences for d1wzua1:

Sequence, based on SEQRES records: (download)

>d1wzua1 c.145.1.1 (A:1-298) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 53953]}
mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlem

Sequence, based on observed residues (ATOM records): (download)

>d1wzua1 c.145.1.1 (A:1-298) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 53953]}
mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
maetakilnpdkvvlipsvehileakrkypnapvvlyvnstaeakayadvtvtsanavev
vkkldsdvvifgpdknlahyvakmtgkkiipvftlddverakklhpnaklmihpecipev
qekadiiastggmikracewdewvvfteremvyrlrklypqkkfyparedafcaitlkni
yeslkdmkykvevpeeiarkarkaiermlem

SCOPe Domain Coordinates for d1wzua1:

Click to download the PDB-style file with coordinates for d1wzua1.
(The format of our PDB-style files is described here.)

Timeline for d1wzua1: