SCOP 1.73: Domain d1wzma2: 1wzm A:503-585

Lineage for d1wzma2 (1wzm A:503-585)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)

8. Domain d1wzma2: 1wzm A:503-585 [121520]
   Other proteins in same PDB: d1wzma1, d1wzma3, d1wzmb1, d1wzmb3
   automatically matched to d1bvza2
   complexed with ca; mutant

Details for d1wzma2

PDB Entry: 1wzm, 3.2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469k

PDB Compounds: (A:) alpha-amylase II

SCOP Domain Sequences for d1wzma2:

Sequence; same for both SEQRES and ATOM records:

>d1wzma2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1wzma2:

• d1wzma2 is new in SCOP 1.73
  
• d1wzma2 appears in SCOP 1.75
  
• d1wzma2 appears in the current release, SCOPe 2.08