Lineage for d1wzlb1 (1wzl B:1-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 protein domains)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658832Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 658847Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (16 PDB entries)
  8. 658849Domain d1wzlb1: 1wzl B:1-120 [121516]
    Other proteins in same PDB: d1wzla2, d1wzla3, d1wzlb2, d1wzlb3
    automatically matched to d1bvza1
    complexed with ca; mutant

Details for d1wzlb1

PDB Entry: 1wzl (more details), 2 Å

PDB Description: Thermoactinomyces vulgaris R-47 alpha-amylase II (TVA II) mutatnt R469L
PDB Compounds: (B:) alpha-amylase II

SCOP Domain Sequences for d1wzlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzlb1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1wzlb1:

Click to download the PDB-style file with coordinates for d1wzlb1.
(The format of our PDB-style files is described here.)

Timeline for d1wzlb1: