SCOPe 2.08: Domain d1wzla3: 1wzl A:121-502

Lineage for d1wzla3 (1wzl A:121-502)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (31 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (8 PDB entries)

8. Domain d1wzla3: 1wzl A:121-502 [121515]
   Other proteins in same PDB: d1wzla1, d1wzla2, d1wzlb1, d1wzlb2
   automated match to d1ji2a3
   complexed with ca

Details for d1wzla3

PDB Entry: 1wzl, 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469l

PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1wzla3:

Sequence; same for both SEQRES and ATOM records:

>d1wzla3 c.1.8.1 (A:121-502) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdclrpmiweekeqn
rglfefykelirlrhrlasltr

Timeline for d1wzla3:

• d1wzla3 first appeared in SCOP 1.73
  
• d1wzla3 appears in SCOPe 2.07