![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries) |
![]() | Domain d1wzla2: 1wzl A:503-585 [121514] Other proteins in same PDB: d1wzla1, d1wzla3, d1wzlb1, d1wzlb3 automated match to d1wzla2 complexed with ca |
PDB Entry: 1wzl (more details), 2 Å
SCOPe Domain Sequences for d1wzla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzla2 b.71.1.0 (A:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1wzla2: