![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries) |
![]() | Domain d1wzkb2: 1wzk B:503-585 [121511] Other proteins in same PDB: d1wzka1, d1wzka3, d1wzkb1, d1wzkb3 automatically matched to d1bvza2 complexed with ca; mutant |
PDB Entry: 1wzk (more details), 2.3 Å
SCOP Domain Sequences for d1wzkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzkb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1wzkb2: