Lineage for d1wzkb2 (1wzk B:503-585)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 676035Protein Maltogenic amylase [51031] (4 species)
  7. 676050Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)
  8. 676060Domain d1wzkb2: 1wzk B:503-585 [121511]
    Other proteins in same PDB: d1wzka1, d1wzka3, d1wzkb1, d1wzkb3
    automatically matched to d1bvza2
    complexed with ca; mutant

Details for d1wzkb2

PDB Entry: 1wzk (more details), 2.3 Å

PDB Description: Thermoactinomyces vulgaris R-47 alpha-amylase II (TVA II) mutatnt D465N
PDB Compounds: (B:) alpha-amylase II

SCOP Domain Sequences for d1wzkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzkb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1wzkb2:

Click to download the PDB-style file with coordinates for d1wzkb2.
(The format of our PDB-style files is described here.)

Timeline for d1wzkb2: