Lineage for d1wzkb1 (1wzk B:1-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376363Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)
  8. 2376371Domain d1wzkb1: 1wzk B:1-120 [121510]
    Other proteins in same PDB: d1wzka2, d1wzka3, d1wzkb2, d1wzkb3
    automated match to d1wzla1
    complexed with ca

Details for d1wzkb1

PDB Entry: 1wzk (more details), 2.3 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt d465n
PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1wzkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzkb1 b.1.18.0 (B:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOPe Domain Coordinates for d1wzkb1:

Click to download the PDB-style file with coordinates for d1wzkb1.
(The format of our PDB-style files is described here.)

Timeline for d1wzkb1: