SCOPe 2.05: Domain d1wzkb1: 1wzk B:1-120

Lineage for d1wzkb1 (1wzk B:1-120)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (6 PDB entries)

8. Domain d1wzkb1: 1wzk B:1-120 [121510]
   Other proteins in same PDB: d1wzka2, d1wzka3, d1wzkb2, d1wzkb3
   automated match to d1wzla1
   complexed with ca

Details for d1wzkb1

PDB Entry: 1wzk, 2.3 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt d465n

PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1wzkb1:

Sequence; same for both SEQRES and ATOM records:

>d1wzkb1 b.1.18.0 (B:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1wzkb1:

• d1wzkb1 first appeared in SCOP 1.73
  
• d1wzkb1 appears in SCOPe 2.04
  
• d1wzkb1 appears in SCOPe 2.06
  
• d1wzkb1 appears in the current release, SCOPe 2.08