SCOPe 2.08: Domain d1wzib1: 1wzi B:0-153

Lineage for d1wzib1 (1wzi B:0-153)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1wzib1: 1wzi B:0-153 [121505]
   Other proteins in same PDB: d1wzia2, d1wzib2
   automated match to d1y7ta1
   complexed with ndp

Details for d1wzib1

PDB Entry: 1wzi, 2 Å

PDB Description: structural basis for alteration of cofactor specificity of malate dehydrogenase from thermus flavus

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1wzib1:

Sequence; same for both SEQRES and ATOM records:

>d1wzib1 c.2.1.5 (B:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqllgsersfqalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

Timeline for d1wzib1:

• d1wzib1 first appeared in SCOP 1.73
  
• d1wzib1 appears in SCOPe 2.07