Lineage for d1wzgb1 (1wzg B:7-213)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 648985Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 648994Protein Heme oxygenase HmuO [89159] (1 species)
  7. 648995Species Corynebacterium diphtheriae [TaxId:1717] [89160] (9 PDB entries)
  8. 649013Domain d1wzgb1: 1wzg B:7-213 [121502]
    automatically matched to d1iw1a_
    complexed with gol, so4, yom

Details for d1wzgb1

PDB Entry: 1wzg (more details), 1.75 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Fe(Salophen)/Wild Type Heme oxygenase
PDB Compounds: (B:) Heme oxygenase

SCOP Domain Sequences for d1wzgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzgb1 a.132.1.1 (B:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d1wzgb1:

Click to download the PDB-style file with coordinates for d1wzgb1.
(The format of our PDB-style files is described here.)

Timeline for d1wzgb1: