SCOPe 2.08: Domain d1wzfb_: 1wzf B:

Lineage for d1wzfb_ (1wzf B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d1wzfb_: 1wzf B: [121500]
   automated match to d1iw1a_
   complexed with gol, so4, yol

Details for d1wzfb_

PDB Entry: 1wzf, 1.85 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Fe(10-COOH-Salophen)/Wild Type Heme oxygenase

PDB Compounds: (B:) Heme oxygenase

SCOPe Domain Sequences for d1wzfb_:

Sequence; same for both SEQRES and ATOM records:

>d1wzfb_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d1wzfb_:

• d1wzfb_ first appeared in SCOP 1.73, called d1wzfb1
  
• d1wzfb_ appears in SCOPe 2.07