Lineage for d1wzea1 (1wze A:0-153)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 688039Protein Malate dehydrogenase [51849] (12 species)
  7. 688135Species Thermus thermophilus [TaxId:274] [82300] (5 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 688140Domain d1wzea1: 1wze A:0-153 [121495]
    Other proteins in same PDB: d1wzea2, d1wzeb2
    automatically matched to d1iz9a1
    complexed with nad; mutant

Details for d1wzea1

PDB Entry: 1wze (more details), 2 Å

PDB Description: structural basis for alteration of cofactor specificity of malate dehydrogenase from thermus flavus
PDB Compounds: (A:) malate dehydrogenase

SCOP Domain Sequences for d1wzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzea1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqllgsersfqalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

SCOP Domain Coordinates for d1wzea1:

Click to download the PDB-style file with coordinates for d1wzea1.
(The format of our PDB-style files is described here.)

Timeline for d1wzea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wzea2