Lineage for d1wzda_ (1wzd A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. Protein Heme oxygenase HmuO [89159] (1 species)
  7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
    Uniprot P71119
  8. Domain d1wzda_: 1wzd A: [121493]
    automated match to d1iw1a_
    complexed with gol, so4, yok

Details for d1wzda_

PDB Entry: 1wzd (more details), 1.35 Å

PDB Description: crystal structure of an artificial metalloprotein: fe(10-ch2ch2cooh-salophen)/wild type heme oxygenase
PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d1wzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzda_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

SCOPe Domain Coordinates for d1wzda_ are not available.

Timeline for d1wzda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wzdb_