SCOPe 2.02: Domain d1wz8e_: 1wz8 E:

Lineage for d1wz8e_ (1wz8 E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein automated matches [190669] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [188102] (1 PDB entry)

8. Domain d1wz8e_: 1wz8 E: [121487]
   Other proteins in same PDB: d1wz8a1
   automated match to d1wz8a1
   complexed with mpd

Details for d1wz8e_

PDB Entry: 1wz8, 1.8 Å

PDB Description: Crystal Structure of Probable Enoyl-CoA Dehydratase from Thermus Thermophilus HB8

PDB Compounds: (E:) enoyl-coa hydratase

SCOPe Domain Sequences for d1wz8e_:

Sequence; same for both SEQRES and ATOM records:

>d1wz8e_ c.14.1.3 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
gfsgkeleeglkalkekrppefp

Timeline for d1wz8e_:

• d1wz8e_ first appeared in SCOP 1.73, called d1wz8e1
  
• d1wz8e_ appears in SCOPe 2.01
  
• d1wz8e_ appears in SCOPe 2.03
  
• d1wz8e_ appears in the current release, SCOPe 2.08